PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA01G14480.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 748aa    MW: 82827.5 Da    PI: 7.3224
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA01G14480.3genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP118.72.8e-37106183178
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      +Cqv+gC+++ls+a++y++rhkvCevh+k+ vv ++++e+rfCqqCsrfh l+efDe+k+sCr+rLa+hn+rrrk q 
  ONIVA01G14480.3 106 CCQVDGCTVNLSSARDYNKRHKVCEVHTKSGVVRIKNVEHRFCQQCSRFHFLQEFDEGKKSCRSRLAQHNRRRRKVQV 183
                      6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.7E-28101168IPR004333Transcription factor, SBP-box
PROSITE profilePS5114130.248104181IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.23E-35105185IPR004333Transcription factor, SBP-box
PfamPF031101.1E-28107180IPR004333Transcription factor, SBP-box
CDDcd002041.36E-4561626No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 748 aa     Download sequence    Send to blast
MSSGLKKKGL EWDLNDWRWD SNLFLATPSN ASPSKCSRRE LGRAEGEIDF GVVDKRRRVS  60
PEDDDGEECI NAATTNGDDG QISGQRGRSS EDEMPRQGAC SSSGPCCQVD GCTVNLSSAR  120
DYNKRHKVCE VHTKSGVVRI KNVEHRFCQQ CSRFHFLQEF DEGKKSCRSR LAQHNRRRRK  180
VQVQAASGPS EQINGPNYLT NLVKNLAALA GTQRNQDMLK NANSAAIASH TGNYVAKGNS  240
LHDSRPHIPV GTESTAEEPT VERRVQNFDL NDAYVEGDEN RTDKIVFKLF GKEPNDFPSD  300
LRAQILSWLS NCPSDIESYI RPGCIILTIY MRLPNWMWDK LAADPAHWIQ KLISLSTDTL  360
WRTGWMYARV QDYLTLSCNG NLILASPWQP AIGNKHQILF ITPIAVACSS TANFSVKGLN  420
IAQPTTKLLC IFGGKYLIQE ATEKLLDDTK MQRGPQCLTF SCSFPSTSGR GFIEVEDHDQ  480
SSLSFPFVVA EEDKLLDTLF QGGVDLDVQS TVEFVLKQDL VFVAVNKRSK PLIDFLLTYT  540
TSSAPMDGTE SAAPAQFLFT PDIAGPSDIT PLHIAATYSD TAGVLDALTD DPQQLGIKAW  600
KNARDATGLT PEDYARKRGH ESYIEMVQNK IDSRLPKAHV SVTISSTTST TDFTEKHASQ  660
SKTTDQTAFD VEKGQQISTK PPLSCRQCLP ELAYRHHLNR FLSTRPAVLS LVAIAAVCVC  720
VGLIMQGPPH IGGMRGPFRW NSLRSGPK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-2898180184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15458KRRRV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0684710.0AK068471.1 Oryza sativa Japonica Group cDNA clone:J013155F18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015614292.10.0PREDICTED: squamosa promoter-binding-like protein 1 isoform X3
RefseqXP_015614297.10.0PREDICTED: squamosa promoter-binding-like protein 1 isoform X3
SwissprotQ9LGU70.0SPL1_ORYSJ; Squamosa promoter-binding-like protein 1
TrEMBLA0A0E0FKF30.0A0A0E0FKF3_ORYNI; Uncharacterized protein
STRINGORGLA01G0103500.10.0(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.11e-107squamosa promoter binding protein-like 1